JustAAA
Home
Questions
Share
Post a Question (with Answer)
Coins
Ask a Question
Log In
Sign Up
Home
/
Biology Questions
Search
Biology Questions
You view your Gram stain of the Gram Standard and see only purple cells. What may...
Adenovirus is a naked icosahedral virus that can be easily inactivated by heat, alcohols, or by...
Herpes simplex virus is an enveloped, icosahedral virus. This virus can be inactivated easily by heat,...
Sickle cell disease (sickle cell anemia) is a relatively common disorder in individuals of African descent...
1. An organism with the genotype AABBCCDD is crossed with an organism with the genotype aabbccdd....
A nosocomial outbreak of bacteremia occurred in an adult oncology unit, and active surveillance for the...
Does genotype have an effect on mobility? If yes, how so? Explain
The inheritance rule was initially discovered by Mendel and it depends on clear or qualitative traits....
Pseudomonas Aeruginosa 1. Is there a childhood vaccine against this microbe? Name the vaccine. 2. If...
Immunity: 1. Which defenses protect us from infection of P. aeruginosa? 2. Does P. aeruginosa induce...
Please answer the following questions and Thank you !- cellular rational for telomers and telomerase 2-Reasons...
We will be using a PDA detector (Perkin Elmer), describe the general operation of a PDA...
We are separating compounds on a column. What physical property do we use to distinguish these...
-The probe stock was provided in DMSO and water. DMSO is toxic to cells at a...
How does Amylose and Amylopectin contribute to the formation of structure and/or texture in a gluten-free...
1) You read a paper that says, “The symbiotic alpha-proteobacterium that first took up residence in...
The permeability of a lipid bilayer for glucose is 10^-8 cm/sec. Consider a cell whose glucose...
Individuals with Klinefelter syndrome have an XXY set of sex chromosomes. Which of these describes a...
Lactic acidosis can have many causes. Rationalize how each of the following conditions can lead to...
1.) Most sexually reproducing organisms are devided into species based on whether or not they have...
Google has offered a $1 million prize to the lab who creates the first sequence map...
a) Explain the role(s) of the FMN cofactor in Complex I? b) Explain the role(s) of...
Please Give an Explination as to why this is correct Which of the following is true...
After transformation, 40 colonies were present on the plate. What is the transformation efficiency of the...
Compare and contrast intensive agriculture and prairie agriculture in terms of their effects on the environment....
The CDC estimate that the 50,000 cases of salmonellosis reported annually may actually represent only 10%...
Explain why it is better to use isolated single colonies for evaluation as compared to growth...
RNA interference (RNAi) is a natural process by which cells suppress the activity of specific genes...
Which medium would be easier to identify contamination, a plate or broth? Explain your answer
Simple retrovirus encodes three essential genes. Draw a diagram that depicts an integrated provirus with these...
1- In the study of infectious disease, why does it matter how closely related two species...
ENERGENTICS OF PHOTOSYNTHESIS (6 pts): One of the common sugars that plants produce is sucrose (12-carbon...
Marine Bio question: What is sediment stabilization?
why is water polar?
The distance between two genes can be calculated by examining the frequency of phenotypic classes of...
"Understand that the number of covalent bonds an atom can form is directly related to the...
1. Compare and contrast epigenetic, Mendelian genetic and Lamarckian theories of inheritance. 2. Discuss how it...
1. As you are walking through the woods with a friend, you notice some ferns growing...
Write the THREE major classes of Proteins based upon their function & explain
Suppose six essential amino acids are required to synthesize protein A, but only five are provided...
Arabidopsis plants have 10 chromosomes ( ve pairs) in their somatic cells. Indicate how many chromosomes...
a hemoglobin with an abnormal electrophoretic mobility is detected in a screening program. Fingerprinting after the...
1. how can you distingish between Brownian motion and true motility 2. although you can see...
Explain one or two important ways in which Hughes's history of the discovery of bat echolocation...
Present a reasonable pathway for the full oxidation of propionate(CH3CH2COOH). How many ATP equvialents will be...
True or False: Unlike translocation of proteins into mitochondria, translocation of proteins into the ER does...
Please answer fully! Explain why DNA has a major and minor groove. What is the significance...
Your son has not had the MMR vaccine (measles, mumps, rubella) because you are apprehensive about...
Explain why a polynucleotide strand has a natural coil to it and why the complementary strands...
What is an example of temporal isolation?
How can a researcher overcome competitive and noncompetitve inhibition?
List four traits that A) Keep desert plants from overheating and B) keep arctic plants from...
1.. Protein X has a single N-terminal ER signal sequence, while protein Y has a single...
Jack and Jill are thinking about starting a family and they come to you with a...
Draw the length-force curve for a sarcomere in a typical striated muscle. Label the axes and...
Please estimate the average distance between two neighboring membrane proteins in E. coli cells.
The axon hillock serves as a site of spatial and temporal summation of presynaptic input. Explain...
How could the same hormone have different, even opposite, effects on different cells (for example epinephrine...
Your laboratory has just gained the license to allow you to research, and commercialize the results...
If the parents are AA x AA, then there is a [x] percent chance that the...
Explain how the citric acid cycle connects to other metabolic pathways, both catabolic and anabolic. List...
1. Suppose we are interested in determining if the density of sugar kelp is similar in...
List the three RNA polymerases active in eukaryotic nuclei. List the general transcription factors that each...
Describe what a pathogenicity island is. List 5 of their main characteristics or features that make...
Relate the absorption spectrum of a pigment to its color and wavelength; apply this knowledge to...
I need to make a CSE style citation with these four references for Microbiology lab- report...
Explain the mechanism of allosteric regulation and provide examples how this mechanism can be used to...
In a population where hair color gene can be determined by 4 alleles B(brown)=0.210654 , b(blonde)...
what would happen to the charge across the cell membrane outside cell potassium concentrations are greatly...
What are all the similar structures (including organelles) found in Plasmodium falciparum vs. trypanosoma cruzi?
Lipid vesicles (small spherical bilayers) provide an ideal in vitro system for the study of pumps...
Apply the concept of the “conservation of energy” to central metabolism. Follow energy from “sources” of...
Consider sequential hermaphrodites. For both protogynous species and protandrous species, which sex do you expect to...
1. According to the ideal gas law (also called the general gas equation), how does temperature...
Explain the thermodynamic principle underlying the sequential ordering of electron carriers in a functional electron transport...
I already have another question pertaining to endosymbiosis. I understand that secondary endosymbiosis involves a eukaryote...
Define a dyad axis. Imagine a nucleosome particle formed by wrapping 168 bp of DNA around...
Make a diagram of the mitochondria with labels, showing where each stage of cellular respiration occurs....
A protein has the following sequence: ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
1) Which of the following bones contributes to the formation of the obutrator foramen of the...
‹
1
2
...
19
20
21
22
23
24
25
...
124
125
›
ADVERTISEMENT
Need Online Homework Help?
Get Answers For Free
Most questions answered within 1 hours.
Ask a Question
ADVERTISEMENT
Active Questions
This is an intro to Java question. Please include pseudo code for better understanding. I am...
asked 4 minutes ago
The distribution under the normal curve can be seen a lot in society, although you may...
asked 16 minutes ago
Verify that the differential equation is exact then solve it dy/dx = (3x^2 - 2xy)/(x^2 -2y)
asked 29 minutes ago
why small capacity generators (such as micro hydro plants) are not considered as PV buses
asked 46 minutes ago
Consider the following Linear Programming model: Minimize -2x+y Subject to x-y<=1 2y-x<=3 x+10y<=50 2x+y<=14 x>=0 y>=0...
asked 1 hour ago
I need to change an integer and put it into an array but in a way...
asked 1 hour ago
Assume P =1 2001 2002
asked 1 hour ago
Last year, 48% of business owners gave a holiday gift to their employees. A survey of...
asked 1 hour ago
Your answers to these kinds of questions demonstrate an ability to comprehend and apply ideas discussed...
asked 1 hour ago
At Litchfield College of Nursing, 87% of incoming freshmen nursing students are female and 13% are...
asked 1 hour ago
FALL_19_ASSIGN-2 Solve the following problems in your command window after turning your ‘diary’ on. Then submit...
asked 2 hours ago
Briefly summarize the arguments of John Hick and then compare and contrast Hick's arguments with the...
asked 2 hours ago