Question

In industry, how to make whey protein isolate and whey protein concentrate protein?

In industry, how to make whey protein isolate and whey protein concentrate protein?

Homework Answers

Answer #1

Whey protein isolates and whey protein concentrates are all by-products of cheese. Whey is a
kind of protein present in the milk which is separated using some enzymes. This obtained
liquid whey is further filtered from water, carbohydrates and other fats. Now this liquid consists
three forms of whey and those are : Whey protein concentrate, Whey protein isolate and hydrolysate.
One thing you should should know is that whey protein concentrate particles are bigger in size
compared to whey isolates. To separate whey protein concentrates in industry they use micro
filtration techniques in which they adopt one micrometer sized membranes and allow them to
pass through. While the rest of the smaller size particles i.e) whey protein isolates are separated
using ultrafiltration (0.25 micrometer).

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
What is a fusion protein and how can it be used to isolate a recombinant protein...
What is a fusion protein and how can it be used to isolate a recombinant protein of interest? Explain each step with reasoning.
How to isolate protein from bacterial cell and how to purify protein? Please write the steps...
How to isolate protein from bacterial cell and how to purify protein? Please write the steps in detail that you need for industrial production. Add a hand-drawn picture as many as possible.Then, confirm the amount of the enzyme by ELISA and Western blot.
You have a protein with a sulfhydryl group (S-H) how could you use that to isolate...
You have a protein with a sulfhydryl group (S-H) how could you use that to isolate your protein? Another option would be to use a 6X histidine linker. How would that work? Would one have an advantage over the other?
You want to isolate a functional integral membrane protein from the cell to study its channel...
You want to isolate a functional integral membrane protein from the cell to study its channel activity. What method would you use to isolate the integral membrane potential? By adding SDS By using Beta-mercaptoethanol By boiling By using a mild-detergent By adding high concentration of salt
You have managed to isolate and partially sequence a protein that you think is involved in...
You have managed to isolate and partially sequence a protein that you think is involved in making cancer cells immortal: PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTGSEMKLTS You want to know if the this protein is novel or has already been characterized. If it is novel, you want to find out whether it is similar to anything that has already been characterized. How would you find out the answers to these questions in less than a minute for less than a dollar? Is it related to...
You isolate a subcellular fraction and find the protein concentration to be 40 mg/mL. a) Show...
You isolate a subcellular fraction and find the protein concentration to be 40 mg/mL. a) Show all calculations and explain how you would prepare 50 µL of a 4 mg/mL final concentration after dilution in 2X sample buffer. (Final concentration after mixing with 2X sample should be 4 mg/mL). b) You are asked to load 20 µg total proteins into a well in the polyacrylamide gel. How many microlitres of the sample prepared above should you load onto the gel?
short procedure of how to isolate pumpking pigment in TLC plate
short procedure of how to isolate pumpking pigment in TLC plate
How do the 3D protein structures make them well suited to carry out their biological functions?
How do the 3D protein structures make them well suited to carry out their biological functions?
Make up your own economic theory on how to get a job in the banking industry...
Make up your own economic theory on how to get a job in the banking industry or a promotion after completing an MBA. Make the theory useful and provide a road map on how to achieve the objective.
The egg industry has recommended that eggs are a good protein source for the elderly. a)...
The egg industry has recommended that eggs are a good protein source for the elderly. a) Cite three reasons to support the egg industry claims. b) Cite three facts that would not support this claim. * Please, do not use handwriting, typing to read it easier and faster.
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT