A company needs 150,000 items per year. It costs the company $720 to prepare a production...

A company needs 150,000 items per year. It costs the company $720 to prepare a production run of these items and $14 to produce each item. If it also costs the company $1.50 per year for each item stored, find the number of items that should be produced in each run so that total costs of production and storage are minimized. _______________items/run

Let X1 and X2 be independent random variables such that X1 ∼ P oisson(λ1) and X2...

Let X1 and X2 be independent random variables such that X1 ∼ P oisson(λ1) and X2 ∼ P oisson(λ2). Find the distribution of Y = X1 + X2.s

Does the electron transfer reaction between the complexes below take place by an innersphere or outersphere...

Does the electron transfer reaction between the complexes below take place by an innersphere or outersphere mechanism? Justify your answer. en = ethylenediamine [Co(en)3]3+ + [Cr(OH2)6]2+

What kinds of behaviors do you observe in people that tell you whether they are powerful?...

What kinds of behaviors do you observe in people that tell you whether they are powerful? Which of these behaviors do you consider socially desirable? Which are undesirable?

Assume that you start by borrowing either $1 million or 120 million yen. Using a starting...

Assume that you start by borrowing either $1 million or 120 million yen. Using a starting yen per dollar exchange of 120 yen per dollar and a one year US interest rate of 6% and 1 year Japanese interest rate of 1% . Explain how a hedge fund can use the carry trade to make profits or incur losses. In your answer show the profits or losses in both dollars and yen in the following three cases. a. The exchange...

MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAV YRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVI GAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTD HSSSSDNIALLVQ 1.  Identify one st

MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAV YRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVI GAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTD HSSSSDNIALLVQ 1.  Identify one stretch of a possible transmembrane region on this protein sequence.

CLARIFY Fahmi Enterprise has a cash-only sales policy. It is considering changing to a credit policy...

CLARIFY Fahmi Enterprise has a cash-only sales policy. It is considering changing to a credit policy of net 30 days. Information related to the current and new policies is given in the table below. The required rate of return is 0.75 percent per month. Current Policy New Policy Price per unit (RM) 15.00 15.50 Cost per unit (RM) 8.00 8.40 Unit sales per month 2,000 2,050 Perform an analysis to show whether or not Fahmi Enterprise should adopt the new...

*Uncertainity principle - bullet A proton and a 9 g bullet each move with a speed...

*Uncertainity principle - bullet A proton and a 9 g bullet each move with a speed 584 m/s, measured with an uncertainty of .01%. If measurements of their respective positions are made simultaneous with the speed measurements, what is the minimum uncertainty in the position measurement for the bullet in units of m and 2 significant figures? Take ?(x)*?(p) = h/(2?)

A conveyor belt is driven by a 19" diameter pulley. The conveyor starts from rest and...

A conveyor belt is driven by a 19" diameter pulley. The conveyor starts from rest and accelerates at a constant rate to 275 RPM in 3 seconds, stays at that speed for 1.8 seconds, and then slows to a stop at a constant rate in 3.2 seconds. a) How far will an object on the conveyor travel during this time? b) What is the maximum speed of the belt?

You are working on a medical-surgical floor and your colleague Nancy discloses to you that her...

You are working on a medical-surgical floor and your colleague Nancy discloses to you that her neighbor, Mrs. Smith, is a patient on the floor. Nancy is concerned because the patient is not doing well; in fact, there has been a Hospice Consult. Nancy feels terrible and stated that the patient asked her not to tell anyone about her condition. The dilemma Nancy presents to you is that Nancy’s own parents are good friends with Mrs. Smith, and it was...

The debits to Work in Process—Assembly Department for May, together with data concerning production, are as...

The debits to Work in Process—Assembly Department for May, together with data concerning production, are as follows: May 1, work in process:    Materials cost, 3,000 units $8,500    Conversion costs, 3,000 units, 50% completed 5,900    Materials added during May, 10,000 units 26,900    Conversion costs during May 30,500    Goods finished during May, 11,500 units 0    May 31 work in process, 1,500 units, 50% completed 0 All direct materials are placed in process at the beginning of the process, and the first-in, first-out...

Project X will require ABC Corp. to purchase equipment at time zero equal to $4,000 Inventory...

Project X will require ABC Corp. to purchase equipment at time zero equal to $4,000 Inventory will increase by $200 Accounts payable will rise by $35 All other working capital components will stay the same $0 Change in operating networking capital is $165 Dollar value of sales in year one $17,000 Dollar value of sales in year two $18,000 Dollar value of sales in year three $19,000 Dollar value of sales in year four $20,000 The fixed cost of producing...

A random sample of 14 ​men's resting pulse rates showed a mean of 71.5 beats per...

A random sample of 14 ​men's resting pulse rates showed a mean of 71.5 beats per minute and standard deviation of 19.9. Assume that pulse rates are Normally distributed. Use the table to complete parts​ (a) through​ (c) below. LOADING... Click the icon to view the​ t-table. a. Find a​ 95% confidence interval for the population mean pulse rate of​ men, and report it in a sentence. Choose the correct answer below​ and, if​ necessary, fill in the answer boxes...

Subject : Effect of the global warming on the economic Question - Laws and policies enacted...

Subject : Effect of the global warming on the economic Question - Laws and policies enacted or currently in place ( list and explain )

Shamrock Shades operates in mall kiosks throughout the southwestern United States. Shamrock purchases sunglasses from bulk...

Shamrock Shades operates in mall kiosks throughout the southwestern United States. Shamrock purchases sunglasses from bulk discounters and sells the sunglasses in the mall kiosks. Shamrock is in the process of budgeting for the coming year and has projected sales of $480,000 for January, $560,000 for February, $720,000 for March, and $760,000 for April. Shamrock’s desired ending inventory is 35 percent of the following month’s cost of goods sold. Cost of goods sold is expected to be 45 percent of...

The ultimate analysis of a sample of petrol was 85.5% C and 14.5% H. Calculate (i)...

The ultimate analysis of a sample of petrol was 85.5% C and 14.5% H. Calculate (i) the stoichiometric A/F ratio; (ii) the A/F ratio when the mixture strength is 90%; (iii) the A/F ratio when the mixture strength is 120%; (iv) the analyses of the dry products for (ii) and (iii); (v) the volume flow rate of the products through the engine exhaust per unit rate of fuel consumption for (iii) when the pressure is 1.013 bar and the temperature...

The domestic demand for radio is given by Q= 5000 - 100 P. The domestic supply...

The domestic demand for radio is given by Q= 5000 - 100 P. The domestic supply curve for radio is given by Q= 150P. Suppose radios can be imported at a world price of $10 per radio. 1) Now suppose domestic radio producers succeed in getting a $5 tariff implemented, how many radios would be imported? 2) How much would be collected in tariff revenue? 3) How much consumer surplus would be transferred to domestic producers? 4) What would the...

1. A cylindrical region of space of radius R contains a uniform magnetic field B with...

1. A cylindrical region of space of radius R contains a uniform magnetic field B with direction into the page. If the magnitude B inside the cylinder changes in time and outside the cylinder it is zero, describe the induced electric field (magnitude and direction) for points inside the cylinder (r < R). Find the magnitude and direction of the induced electric field at r = 5.00 cm if the magnetic field changes at a constant rate from 0.500T to...

1,Sales were $72,000. Cost of merchandise sold was 55% of its sales price. 70% of the...

1,Sales were $72,000. Cost of merchandise sold was 55% of its sales price. 70% of the sales were on open account. [Note: Record the complete entry for the sales first and the complete entry for the expenses second] 2,Transaction 2 The company quickly acquired $42,000 in inventory, 70% of which was paid for in cash. The rest was acquired on open accounts that were payable after 30 days.

A proton and an electron are fixed in space with a separation of 837 nm. Calculate...

A proton and an electron are fixed in space with a separation of 837 nm. Calculate the electric potential at the midpoint between the two particles. potential: V Find the magnitude of the electric field at the same point. magnitude of field: N/C The direction of field is toward the proton. toward the electron. another direction. undetermined.