Question

How would you purify the amino acids that result from breaking down of milk protein (~...

How would you purify the amino acids that result from breaking down of milk protein (~ 0.01 g)

Thank you!

Homework Answers

Answer #1

Solution:

There is no any direct purification method to purify the amino acids which break down milk into protein.

First checking with Thin Layer Chromatography (TLC) weather your compound is moving on TLC with Dichloromethane (DCM), methanol (MeOH) solvent system. If it is moving with this solvent system it's pretty easy to purify by using silica gel chromatography. If we can run it on normal silica gel Thin Layer Chromatography (TLC) plates then most likely you can do it on normal silica gel. You could also protect the carboxylic acid or amine for purification and cleave off afterwards.

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
How do differences in amino acid sequences lead to different protein functions? A. Different amino acids...
How do differences in amino acid sequences lead to different protein functions? A. Different amino acids produce different proteins based on the bonds formed between them B. Differences in amino acids lead to the recycling of proteins, which produces other functional proteins. C. Different amino acids cause rearrangements of amino acids to produce a functional protein. D. Differences in the amino acids cause post-translational modification of the protein, which reassembles to produce a functional protein.
Where would you expect to find polar amino acids in a protein in an membrane environment?...
Where would you expect to find polar amino acids in a protein in an membrane environment? What force drives this behavior? Would you expect to find them in the same location if the protein was in an aqueous environment
Estimate how long (in amino acids) a continuous chain of amino acids would have to be...
Estimate how long (in amino acids) a continuous chain of amino acids would have to be in order for that chain to compose a cylinder with the dimensions of 80 um in diameter and 1 cm long. Assume that the chain extends in one direction, until it comes to the end of the cylinder (1cm), and turns 180 degrees to loop back to continue in the other direction, etc. The final cross section of this cylinder would look similar to...
What is the energy produced from digesting Turkey (protein). Turkey (protein) many essential amino acids such...
What is the energy produced from digesting Turkey (protein). Turkey (protein) many essential amino acids such as tryptophan, threonine, isoleucine, lysine and phenylalanine. Threonine is a large amino acid and will broken be down into two products: pyruvate and succinyl CoA which are then fed into the citric acid cycle and electron transport chain. Phenylalalanine is broken down into acetyl CoA and fumarate and fed into the citric acid cycle and electron transport chain. Please write down all the calculations...
If 600 amino acids are condensed to form a protein, how many peptide bonds are being...
If 600 amino acids are condensed to form a protein, how many peptide bonds are being formed? How many molecules of H2O are split out during the condensation? If the average molecular weight of a free amino acid is 130 daltons, what is the molecular weight of the protein?
Assume that a typical protein has 100 amino acids and a “ballpark” molecular weight for an...
Assume that a typical protein has 100 amino acids and a “ballpark” molecular weight for an amino acid is 100 g/mol. How many protein molecules are present per 70 kg [average weight of a human] of hydrated cells? [2 points] If a protein’s typical dimension is 10 angstroms, could the distance between Pittsburgh and Los Angeles be spanned by aligning the protein molecules end-to-end? [2 points]
A protein is made up from the following amino acids: Gly-Phe-Lys-Pro-Met-Trp 1.) List the codons for...
A protein is made up from the following amino acids: Gly-Phe-Lys-Pro-Met-Trp 1.) List the codons for the amino acids 2.) List the DNA base sequence that gave rise to this protein.
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form a disulfide bond. However, only two of them actually make a disulfide bond in the protein. Propose a series of experiments that would allow you to determine between which two amino acids the disulfide bond occurs. Pick from: Salting out, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, SDS PAGE, affinity chromatography. HINT: do not overcomplicate the question.
How to isolate protein from bacterial cell and how to purify protein? Please write the steps...
How to isolate protein from bacterial cell and how to purify protein? Please write the steps in detail that you need for industrial production. Add a hand-drawn picture as many as possible.Then, confirm the amount of the enzyme by ELISA and Western blot.
protein can vary in size from approximately 40 to 34000 amino acids. a) why. is there...
protein can vary in size from approximately 40 to 34000 amino acids. a) why. is there a lower limit to the size of proteins? b)why is there an upper limit to the size of plypeptides?
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT