Question

protein can vary in size from approximately 40 to 34000 amino acids. a) why. is there...

protein can vary in size from approximately 40 to 34000 amino acids.

a) why. is there a lower limit to the size of proteins?

b)why is there an upper limit to the size of plypeptides?

Homework Answers

Answer #1

a) Shorter polypeptides containing less than 40 residues cannot maintain a stable fold as there are not enough functional groups to stabilize the folded structure. Hence, around 40-50 residues of amino acids are necessary to perform a particular biochemical function. Therefore, 40-50 residues appears to be the lower limit for a functional domain size.

b) Protein sizes may range to several thousand residues in multi-functional or structural proteins. However, beyond a certain size the longer polypeptide will include increasing mistakes during transcription and translation due to the longer corresponding mRNA and gene.

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
How do differences in amino acid sequences lead to different protein functions? A. Different amino acids...
How do differences in amino acid sequences lead to different protein functions? A. Different amino acids produce different proteins based on the bonds formed between them B. Differences in amino acids lead to the recycling of proteins, which produces other functional proteins. C. Different amino acids cause rearrangements of amino acids to produce a functional protein. D. Differences in the amino acids cause post-translational modification of the protein, which reassembles to produce a functional protein.
how the amine neutralizes the HCl. explain why amino acids can neutralize acids (act as bases)...
how the amine neutralizes the HCl. explain why amino acids can neutralize acids (act as bases) and neutralize bases (act as acids). (Proteins, made from amino acids, are also amphoteric. This makes proteins one of the body's important buffer systems) how the amine makes the solution basic. what must a base do to neutralize an acid (HCI) . i.e. make the acid no longer dangerous?
Amino acids are produced from (a) proteins (b) fatty acids (c) essential oils (d) a-keto acids.
Amino acids are produced from (a) proteins (b) fatty acids (c) essential oils (d) a-keto acids.
Amino acids are produced from (a) proteins (b) fatty acids (c) essential oils (d) a-keto acids.
Amino acids are produced from (a) proteins (b) fatty acids (c) essential oils (d) a-keto acids.
Amino acids can be represented as A-Ri-B, where the Ri can be any of the 26...
Amino acids can be represented as A-Ri-B, where the Ri can be any of the 26 different amino acids. Nylon precursors can be represented as A-R3-A and B-R4-B. Using the A-R-B representation for amino acids and the A-R-A & B-R-B representation for nylon precursors, diagram what the repeat structure of proteins and of nylons look like.
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form a disulfide bond. However, only two of them actually make a disulfide bond in the protein. Propose a series of experiments that would allow you to determine between which two amino acids the disulfide bond occurs. Pick from: Salting out, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, SDS PAGE, affinity chromatography. HINT: do not overcomplicate the question.
Fatty acids that are unsaturated have: Select one: a. an amino group b. a double bond...
Fatty acids that are unsaturated have: Select one: a. an amino group b. a double bond c. an excess of protons d. a carboxyl group The following structure is solid at room temp with the maximum amount of hydrogens attached and has no double bonds. What is it? Select one: a. An unsaturated fat b. A protein c. A solute d. A saturated fat Although there are a limited number of amino acids, many different types of proteins exist because...
A protein is made up from the following amino acids: Gly-Phe-Lys-Pro-Met-Trp 1.) List the codons for...
A protein is made up from the following amino acids: Gly-Phe-Lys-Pro-Met-Trp 1.) List the codons for the amino acids 2.) List the DNA base sequence that gave rise to this protein.
Why is dietary protein deficiency associated with increased susceptibility to infections? a lack of dietary protein...
Why is dietary protein deficiency associated with increased susceptibility to infections? a lack of dietary protein leads to a decrease in productive sleep patterns b amino acids are required to make antibodies (proteins) c this is an indication that someone is malnurished d lack of proteins decreases energy
How would you purify the amino acids that result from breaking down of milk protein (~...
How would you purify the amino acids that result from breaking down of milk protein (~ 0.01 g) Thank you!
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT