Question

How many unique sequences of amino acids 15 peptides long can you make using only: 1....

How many unique sequences of amino acids 15 peptides long can you make using only:

1. Hydrophobic amino acids with a benzine ring

2. Hydrophylic acidic amino acids

Homework Answers

Answer #1

Ans-1.

There are three hydrophobic amino acids having benzene ring in their structures are Phenylalanine, Tyrosine and Tryptophan.

The number of unique sequences of amino acids 15 peptides long

= (No. of different amino acid) (No. of amino acids in a peptide)

= 315

Ans-2.

Among all amino acids, there are two acidic amino acids i.e. Aspartic acid and Glutamic acid which are the hydrophilic in nature.

Thus, The number of unique sequences of amino acids 15 peptides long

= (No. of different amino acid) (No. of amino acids in a peptide)

= 215

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
1. Within 10 amino acids, only two types of amino acids are used to make peptides,...
1. Within 10 amino acids, only two types of amino acids are used to make peptides, and micelles are prepared using these. 2. Considering the properties of the hydrophobic anti-cancer agent and siRNA, the hydrophobic anti-cancer agent is designed to be encapsulated inside the micelle and the siRNA is designed to bind to the micelle surface. Design a peptide that satisfies the above two conditions.
How many distinct tetra peptides cane made from the two amino acids leucine and histidine? (each...
How many distinct tetra peptides cane made from the two amino acids leucine and histidine? (each amino acid maybe used more than once)
Common proteins are polymers of 20 different amino acids. How many amino acids are necessary for...
Common proteins are polymers of 20 different amino acids. How many amino acids are necessary for a protein polymer to have at least as many possible different sequences as there are atoms in the Universe? (There are about 2 × 1056 moles of atoms in the Universe.)
How many codons code for amino acids, including the methionine codon? (1) ______ (1) How many...
How many codons code for amino acids, including the methionine codon? (1) ______ (1) How many codons do not code for amino acids? _______ (1) What do the codons that do not code for amino acids code for? Our book (and lecture) made the point at least twice that eukaryotic pre-mRNA transcripts do not have a definite, consistent end. What does this mean, and why is it so? (2)
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form a disulfide bond. However, only two of them actually make a disulfide bond in the protein. Propose a series of experiments that would allow you to determine between which two amino acids the disulfide bond occurs. Pick from: Salting out, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, SDS PAGE, affinity chromatography. HINT: do not overcomplicate the question.
How many nondecreasing sequences of length 10 can you make from the set {0,1,2,...,100}? An example...
How many nondecreasing sequences of length 10 can you make from the set {0,1,2,...,100}? An example is 0,0,5,10,10,10,15,25,35,92.
How do you determine a charge on ionizable amino acids: asp, arg, lys, his, glu. I...
How do you determine a charge on ionizable amino acids: asp, arg, lys, his, glu. I know I have to compare P.H. vs Pk but I don’t know where to go from there. Example: if the ph is 2 and glu pk= 4.3, would this make it negative since it’s acidic in nature? —> P.H. 2 and His with pk of 6
How many ATP equivalents (ATP -> ADP + Pi) are needed to make a 200 amino...
How many ATP equivalents (ATP -> ADP + Pi) are needed to make a 200 amino acid polypeptide from a mRNA template, amino acids and tRNA molecules. GTP -> GDP + Pi counts as one ATP equivalent and ATP -> AMP + 2 Pi counts as 2 equivalents.
1: How many passwords you can make using the letters in the word "COFFEE"? 2: How...
1: How many passwords you can make using the letters in the word "COFFEE"? 2: How many 12-digit Hexadecimal numbers end in 55AA?
How many valid 3 digit numbers can you make using the digits 0, 1, 2 and...
How many valid 3 digit numbers can you make using the digits 0, 1, 2 and 3 without repeating the digits? How about with repeating?
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT