Question

If joint ventures are so beneficial to the firms involved, why would a firm want to...

If joint ventures are so beneficial to the firms involved, why would a firm want to do anything important on its own?

Homework Answers

Answer #1

If joint ventures are so beneficial to the firms involved, why would a firm want to do anything important on its own?

  • Joint ventures perform a task together with the combined workforce and leadership
  • Inspite of being bound by a JV, each firm also has its own individual identity
  • Both firms are aware of the fact that the JV might end anytime
  • So both firms want to do anything important on its own so as to benefit in the future when they are running independently
  • During a JV, both firms have their individual customer base, hence to increase the individual brand image both firms want to do anything important on its own
Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
There are 4 firms: A, B, C and F. They want to form a joint venture...
There are 4 firms: A, B, C and F. They want to form a joint venture (JV). The returns of the JV are as follows: – If all the firms form a JV, the JV earns $100m – The JV of A, B and C earns $100m – The JV of A, B and F earns $80m – The JV of A, C and F earns $70m – The JV of B, C and F earns $100m – The JV...
List as many reasons as you can for why a firm would want to differentiate its...
List as many reasons as you can for why a firm would want to differentiate its products from its competitors. Why might a firm choose a product similar to its competitor?
why would a firm use an alliance, joint venture, and merger/ acquisition? and how will the...
why would a firm use an alliance, joint venture, and merger/ acquisition? and how will the implementation effort differ in each ?
Two firms are involved in Bertrand competition. The marginal cost for firm 1 and 2 are...
Two firms are involved in Bertrand competition. The marginal cost for firm 1 and 2 are mc1=1 and mc2=0. As usual, the consumers purchase only from the firm with a lower price. If p1=p2, then each firm will sell to 50% of the consumers. Find any two Nash Equilibria of the game. And explain why they are Nash Equilibria.
Consider the following simultaneous-move, one-shot game facing two firms (Firm A and Firm B), with the...
Consider the following simultaneous-move, one-shot game facing two firms (Firm A and Firm B), with the payoffs given in Table I. Assume the firms are not able to coordinate or communicate. Firm A and B each has three strategic options. Table I Firm B Firm A Strategy Low average high Small 100, 125 300, 200 200, 190 Medium 250, 0 470, 340 480, 300 Large 300, -100 450, 450 475, 360 (a). For each of the firms, identify the dominant...
Explain why firms would want to maintain a bank balance exceeding the compensating balance requirements.
Explain why firms would want to maintain a bank balance exceeding the compensating balance requirements.
Why is the topic of heart disease and stroke so important? What disparities are involved? provide...
Why is the topic of heart disease and stroke so important? What disparities are involved? provide article findings
why would a lender be interested in a firms liquidity ratios what raitos would you be...
why would a lender be interested in a firms liquidity ratios what raitos would you be most interested in if you were planning to invest in a firm? why does the IRS allow firms to depreciate assets? why do we use ratios to analyze and compare firms instead of just comparing their balance sheets and income statements?
You have managed to isolate and partially sequence a protein that you think is involved in...
You have managed to isolate and partially sequence a protein that you think is involved in making cancer cells immortal: PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTGSEMKLTS You want to know if the this protein is novel or has already been characterized. If it is novel, you want to find out whether it is similar to anything that has already been characterized. How would you find out the answers to these questions in less than a minute for less than a dollar? Is it related to...
Once your chosen business is more established, you decide to get involved in a joint venture...
Once your chosen business is more established, you decide to get involved in a joint venture with a foreign firm. The contract for the joint venture gives you the right to buy the project in three years. You worry that the foreign firm has been bribing government officials to obtain an economic advantage over other companies. Do you have any reason to be concerned about the possible bribery if you purchase the venture in three years? Why or why not?...