Question

Do you think that if the PMT (city of Denver and Greiner/Momson Knudsen) managed the project...

Do you think that if the PMT (city of Denver and Greiner/Momson Knudsen) managed the project effectively, would the cost of building the airport increase dramatically as it did?

Homework Answers

Answer #1

The bad decision making, underestimation of Project plans,challenges and wrong business decisions taken were the key reason for the downfall of the Airport project so, overall project was not handled effectively by PMT.There were

  • Risk Management failure
  • Architecture and design failures
  • Project management failures

Yes of course, cost went dramatically increasing due to many factors. Delay of baggage system led to delay of project by nearly 16 months which caused very much expensive.To run empty airport,loans and interst on them increased due to this delay causing drastic increase in expenditure.Maintainence cost were high too, likely 1M $ at a time.

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
Why was managed care developed? Do you think managed care is a good way to provide...
Why was managed care developed? Do you think managed care is a good way to provide healthcare services? Why or why not?
Looking at the current managed care models, which do you think is the most advantageous, and...
Looking at the current managed care models, which do you think is the most advantageous, and why?
You have managed to isolate and partially sequence a protein that you think is involved in...
You have managed to isolate and partially sequence a protein that you think is involved in making cancer cells immortal: PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTGSEMKLTS You want to know if the this protein is novel or has already been characterized. If it is novel, you want to find out whether it is similar to anything that has already been characterized. How would you find out the answers to these questions in less than a minute for less than a dollar? Is it related to...
What do you think can be done through managed care/health insurance to alleviate the huge burden...
What do you think can be done through managed care/health insurance to alleviate the huge burden that is now placed on families and friends around caring for the elderly? Be specific when offering possible solutions and ideas.
Responsibility Accounting: What is cost center and what types of center do you think the following...
Responsibility Accounting: What is cost center and what types of center do you think the following would be: ____ Bakery ____ Accounting Department ____ Product line – original Chessecake _____ Human Resources Dept ______ Cheesecake Café at O’Hare Airport
Why do you think Toyota is planning on increasing their investment in the US? Should there...
Why do you think Toyota is planning on increasing their investment in the US? Should there be a concern about increased cost of production as Japan’s investment increase? What role did tariffs play in Toyota’s decision to build new plants, and refurbish existing plants in the US? Do you think the tax reform and the tax rate decrease of approximately 43 percent on corporations in the US played a role in Toyota’s decision?
This is for AT&T: Do you think your organization is operating technology effectively? Do you see...
This is for AT&T: Do you think your organization is operating technology effectively? Do you see any ways in which it could improve its technical efficiency, innovativeness, or ability to respond to the customers?
You are articulating a project for the first time. What do you think about the process...
You are articulating a project for the first time. What do you think about the process of creating a project so far? Have you found it difficult or appropriately challenging? What are some of the things that you learned about the process and about yourself as a researcher? If you could go back in time, what are some of the things you know today that you would tell yourself? what are some of the key lessons you learned? Similarly, what...
Looking around your city, what businesses do you think come closest to the model of a...
Looking around your city, what businesses do you think come closest to the model of a perfectly competitive market? Explain why this is the case using correct economic terms and concepts.
If you were the mayor of the city of Buffalo, NY, what would you do to...
If you were the mayor of the city of Buffalo, NY, what would you do to increase the standard of living for local people? PLEASE HELP!
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT