Question

. If you have the same protein loaded in two different lanes of an SDS-PAGE stained...

. If you have the same protein loaded in two different lanes of an SDS-PAGE stained with Coomasie blue, and one lane has a darker, thicker band of protein than the other lane, can you say that there is more protein in the lane with the darker band? Why or why not?

Science   Chemistry   
0 0
Add a commentTranscribed image text
Next >

Homework Answers

Answer #1

0 0
Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
during sds page, if You see that the protein patterns (protein masses and protein intensity) differ...
during sds page, if You see that the protein patterns (protein masses and protein intensity) differ between the different species and different tissues. Briefly explain why the patterns differ ? and if you rated the quality of one or more lanes as poor, explain what the problem could have been. Are you able to store samples in the fridge and run them at a later date ?
1a. After performing SDS-PAGE of a protein extract, there will be a number of protein "bands"...
1a. After performing SDS-PAGE of a protein extract, there will be a number of protein "bands" in a lane of the gel. In a single "band" all proteins have the same ___. Select one: a. molecular mass b. R-groups with mostly hydrophobic amino acids c. tertiary structure d. function 1b. Solve for x. Your answer should have three significant digits. (the answer is not 15.1) 10x = 151
You have purified protein Q. SDS page shows a single band of 60 kDA. In a...
You have purified protein Q. SDS page shows a single band of 60 kDA. In a gel filtration experiment, protein Q elutes between alchol dehyrogenase (MW = 160 kDa) and betaamylase (MW = 190 kDa). How many subunits are intact in protein Q?
Which of the following methods can be used to detect a protein band in an organelle...
Which of the following methods can be used to detect a protein band in an organelle fraction for which there is no enzyme assay? A monoclonal antibody specific for the protein is available and each fraction obtained from the fractionation experiment will be assayed. a. Immunoelectron microscopy b. ELISA assay c. Western blotting d. Immunofluorescence A membrane spanning protein that is a channel for potassium ion transport is made up of six copies of a single polypeptide. Potassium ions are...
Imagine that you have just run protein gel electrophoresis using the same protein ladder that we...
Imagine that you have just run protein gel electrophoresis using the same protein ladder that we used in this experiment as your molecular weight standard. In the test sample (in the lane just to the right of the ladder), after running the gel you stain for a protein band that is positioned almost exactly halfway between the Phosphorylase and BSA bands on the ladder. A colleague in the lab points to the band and says it must have a molecular...
You want to express a human protein in E. coli that has been transformed by a...
You want to express a human protein in E. coli that has been transformed by a DNA plasmid containing the gene sequence for this protein. The sequence of the protein (in one-letter code) that will be expressed in E. coli is: MAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSV RCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRL RVPGCNQDLDVQKKLYDCLEEHLHHHHHHHHHH A. You proceed to express the protein, lyse open the cells, and remove the insoluble debris. With the soluble fraction of the lysate that contains your protein, you proceed to perform affinity chromatography. What specific kind...
1) You have two unknown, unlabeled clear solutions. One is DNA and the other is protein....
1) You have two unknown, unlabeled clear solutions. One is DNA and the other is protein. How do you determine which solution is DNA, which one is protein 2)In an SDS gel larger proteins travel ________________(longer/shorter) distance compared to smaller proteins. 3) Assuming that the isolation and purification of Rubisco went as expected, which fraction isolated should have the highest concentration of pure Rubisco? Please explain. (There was a total of 11 fractions) 4) Your first task as a graduate...
You are offered jobs with identical responsibilities by two different firms in the same industry. One...
You are offered jobs with identical responsibilities by two different firms in the same industry. One has no debt in its capital structure, and the other has 99 percent debt in its capital structure. Will you require a higher level of compensation from one firm than from the other? If so, which firm will have to pay you more?
Let’s say that you have three dice that are different colors; one is blue, one is...
Let’s say that you have three dice that are different colors; one is blue, one is pink, and one is grey. Figure out the probability of each of the following outcomes, showing as much work as you can: b) rolling a 3 or 4 on the pink die AND a 3 or 4 on the grey die on the same roll
suppose you have two different sets of data. although they both have the same mean, their...
suppose you have two different sets of data. although they both have the same mean, their normal distribution or bell curve looks completely different. why?
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT