Question

what type of ion exchange would you select to separate amino acids and what pH conditions...

what type of ion exchange would you select to separate amino acids and what pH conditions would you select ? 2- offer alternative methods from literature?

Homework Answers

Answer #1

Anion exchange chromatography.

All appropriately charged proteins will bind the resin. For example, if an anion exchange resin is used at a pH of 7.5, in general, all proteins that have a pI < 7.5 will carry a net negative charge and will bind the positively charged resin. A salt gradient is then used to separate the protein of interest from other bound proteins — proteins will be eluted in an order depending on their net surface charge. Proteins with pI values closer to 7.5 will elute at a lower ionic strength, and proteins with very low pI values will elute at a high salt concentration.

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
what order, first to last, would the amino acids Lys, Glu and His elute from an...
what order, first to last, would the amino acids Lys, Glu and His elute from an anion exchange column at pH 6.0? First__ Second__ Third__
Are there any amino acids that you think would make a good buffer at pH=8.0? Why?...
Are there any amino acids that you think would make a good buffer at pH=8.0? Why? List them.
(a) In what order would the amino acids Arg, His, and Leu be eluted from a...
(a) In what order would the amino acids Arg, His, and Leu be eluted from a carboxymethyl column at pH 6? (b) In what order would Glu, Lys, and Val be eluted from a diethylaminoethyl column at pH 8? Can anyone show me step by step how to solve this? I don't understand how to find the charges of the amino acids and how pH affects it?
(a) In what order would the amino acids Arg, His, and Leu be eluted from a...
(a) In what order would the amino acids Arg, His, and Leu be eluted from a carboxymethyl column at pH 6? (b) In what order would Glu, Lys, and Val be eluted from a diethylaminoethyl column at pH 8?
The type of bond made between 2 amino acids is hydrogen bond? Select one: a. peptide...
The type of bond made between 2 amino acids is hydrogen bond? Select one: a. peptide bond b. hydrogen bond c. amine bonds d. phosphordiester bond e. diester bond
You are trying to separate a mixture of Glutamate, Asp, and Leu. You run the mixture...
You are trying to separate a mixture of Glutamate, Asp, and Leu. You run the mixture over an anion exchange column (buffer pH = 6.0). In what order should the amino acids elute? Hint: Consider the side chain pKas
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form a disulfide bond. However, only two of them actually make a disulfide bond in the protein. Propose a series of experiments that would allow you to determine between which two amino acids the disulfide bond occurs. Pick from: Salting out, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, SDS PAGE, affinity chromatography. HINT: do not overcomplicate the question.
In an experiment, you have isolated amino acids from the cytosol of a cell. You discover...
In an experiment, you have isolated amino acids from the cytosol of a cell. You discover that nucleic acid molecules appear to be attached to the amino acids. It is most likely that you have isolated what type of nucleic acid? DNA Double-stranded RNA tRNA rRNA mRNA
1. Which of these amino acids would probably NOT be found in the interior of a...
1. Which of these amino acids would probably NOT be found in the interior of a globular protein? Select one. Group of answer choices A. Arginine B. Valine C. Methionine D. Alanine E. Leucine 2. In which type of protein secondary structure are the peptide bonds usually hydrogen bonded with water? Select one. Group of answer choices A. Loop B. More than one of these C. Alpha-helix D. Turn E. Beta-sheet
How would you purify the amino acids that result from breaking down of milk protein (~...
How would you purify the amino acids that result from breaking down of milk protein (~ 0.01 g) Thank you!
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT