Question

Explain as clearly as possible how you might go about purifying a protein using metal chelation/IMAC...

Explain as clearly as possible how you might go about purifying a protein using metal chelation/IMAC chromatography, and what would be suitable binding and elution buffers for such a column?

Science   Chemistry   
0 0
Add a commentTranscribed image text
Next >

Homework Answers

Answer #1

0 0
Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
How would you separate a mixture of benzhydrol, benzophenone, and biphenyl using column chromatography (i.e. which...
How would you separate a mixture of benzhydrol, benzophenone, and biphenyl using column chromatography (i.e. which is the best eluent or mixture of eluent, order of addition of the eluents, order of elution, ect.)?
Some characteristics of three proteins are listed in the table below: Protein Molecular Weight (Da) Isoelectric...
Some characteristics of three proteins are listed in the table below: Protein Molecular Weight (Da) Isoelectric point (pI) Does the Protein Contain a heme moiety? 1 65,000 5.5 No 2 54,000 10.0 No 3 14,500 4.5 Yes a.(2 points) What type of chromatography separates proteins based on size? b. (2 points) What type of chromatography separates proteins based on their charge? c.(10 points) Could gel filtration chromatography be used to separate a mixture containing Protein 2 and 3? Clearly explain...
1. Thoroughly explain how you would go about charging an object by using induction. Include as...
1. Thoroughly explain how you would go about charging an object by using induction. Include as many details as possible to get full credit. Include diagrams if you wish. 2. An unbalanced electric dipole consists of two charges: q1 = +13.1 nC and q2 = -4.4 nC, which are separated by 55.0 μm. What is the total electric potential energy stored in this system of charges? 3. Explain the primary purpose of a lightning rod, and describe how it works.
You want to express a human protein in E. coli that has been transformed by a...
You want to express a human protein in E. coli that has been transformed by a DNA plasmid containing the gene sequence for this protein. The sequence of the protein (in one-letter code) that will be expressed in E. coli is: MAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSV RCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRL RVPGCNQDLDVQKKLYDCLEEHLHHHHHHHHHH A. You proceed to express the protein, lyse open the cells, and remove the insoluble debris. With the soluble fraction of the lysate that contains your protein, you proceed to perform affinity chromatography. What specific kind...
Your coworker purified a 20 kDa histidine-tagged protein using immobilized metal affinity chromatography (Qiagen Ni-NTA resin)....
Your coworker purified a 20 kDa histidine-tagged protein using immobilized metal affinity chromatography (Qiagen Ni-NTA resin). Her protein eluted partially in the wash step and also eluted with many contaminating proteins. How would you suggest trouble-shooting this experiment to improve the purification?
“If you had a large collection of data, how might you go about determining whether the...
“If you had a large collection of data, how might you go about determining whether the distribution was normal?”
How might you go about computing z scores for a set of raw scores?
How might you go about computing z scores for a set of raw scores?
How would you solve a problem using a new technology? what  methods would you go about?
How would you solve a problem using a new technology? what  methods would you go about?
As a newly promoted business analyst how might you go about forming a corporate strategy for...
As a newly promoted business analyst how might you go about forming a corporate strategy for your organization?
You are performing a separation experiment with gas chromatography and notice that your peaks have overlapping...
You are performing a separation experiment with gas chromatography and notice that your peaks have overlapping elution times. Provide three possible approaches you could take to improve the resolution of the peaks. Explain how these changes would provide a higher resolution using the resolution equation. Which of your listed approaches would be the most cost effective?
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT