Question

In paper electrophoresis, you separated amino acids based on charge. What is the variable this time...

In paper electrophoresis, you separated amino acids based on charge. What is the variable this time in SDS-PAGE? How do you know that there is only one variable in this separation? Explain in detail.

Homework Answers

Answer #1

The most important variable must be the [H+] which is related to the pH

the pH is essentially the H+ ions in solution.

Note that the amin acids will charge positively and/or negatively according to the pH

Some of the amino acids will get protons from solution to form NH2 + H+ --> NH3+

and vice versa.

Some carboxlic acids from amino acids will free/get H+ ions in soution COOH --> COO- + H+

That is the only variable, since the amino acids will only charge with respect to pH

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form a disulfide bond. However, only two of them actually make a disulfide bond in the protein. Propose a series of experiments that would allow you to determine between which two amino acids the disulfide bond occurs. Pick from: Salting out, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, SDS PAGE, affinity chromatography. HINT: do not overcomplicate the question.
How do you determine a charge on ionizable amino acids: asp, arg, lys, his, glu. I...
How do you determine a charge on ionizable amino acids: asp, arg, lys, his, glu. I know I have to compare P.H. vs Pk but I don’t know where to go from there. Example: if the ph is 2 and glu pk= 4.3, would this make it negative since it’s acidic in nature? —> P.H. 2 and His with pk of 6
how the amine neutralizes the HCl. explain why amino acids can neutralize acids (act as bases)...
how the amine neutralizes the HCl. explain why amino acids can neutralize acids (act as bases) and neutralize bases (act as acids). (Proteins, made from amino acids, are also amphoteric. This makes proteins one of the body's important buffer systems) how the amine makes the solution basic. what must a base do to neutralize an acid (HCI) . i.e. make the acid no longer dangerous?
Be able to draw the various ionization states of amino acids and small peptides at various...
Be able to draw the various ionization states of amino acids and small peptides at various pH values. This is a question on my study guide: I just wanted to know how you would do this. If somebody can explain this to me abd how you figure this out would be great.
Given the following DNA sequence, what is the mRNA sequence? How many amino acids would be...
Given the following DNA sequence, what is the mRNA sequence? How many amino acids would be created from this strand of DNA? TAC GGC CTA TAC GTA Please explain this process, don't just write the answer. I think it will be ARG CCG GAT ATG CAT, but I'm not sure. How would I know how many amino acids would be created? My teacher didn't really explain that part to me.
A peptide of five amino acids contains one serine, one asparagine, one lysine and two aspartic...
A peptide of five amino acids contains one serine, one asparagine, one lysine and two aspartic acids. At pH 7.4, this peptide would have: a) how many positive charge(s) b) how many negative charge(s) c) what is the overall net charge? In a lab you are asked to pipette 130 mL using a pipette with a range of 20-200 mL. This pipette has recently been calibrated so is functioning correctly. You correctly move the dial of the pipette to 130...
Many times, multiple variables can be correlated, affecting the outcome of the dependent variable. Describe, in...
Many times, multiple variables can be correlated, affecting the outcome of the dependent variable. Describe, in detail, the process for determining if more than one variable contributes to the outcome of a single dependent variable. How accurate is a regression analysis and how do you know? What attributes of the analysis will determine whether the analysis is accurate and to what extent? Can inaccurate regression analyses be used to an analyzer’s benefit? Explain in detail
Discuss with examples what you understand of a literature review based paper. (10) 4. How do...
Discuss with examples what you understand of a literature review based paper. (10) 4. How do you formulate a research methodology. Give different types you are familiar with?
1.A recent research paper demonstrated that cAMP bound to CAP acts more strongly on the lac...
1.A recent research paper demonstrated that cAMP bound to CAP acts more strongly on the lac operon than on the arabinose operon. Given what you know about catabolite regulation, and the lac operon, list the order of preference of utilisation of the three sugars; arabinose, lactose and glucose. 2.A 3000 bp region of the human genome encodes two genes. One of the genes encodes a protein of 700 amino acids and the other gene encodes a protein of 310 amino...
Based on your own experiences of working in teams and the readings, prepare a paper on...
Based on your own experiences of working in teams and the readings, prepare a paper on the advantages and disadvantages of working in teams. As part of that paper, respond to the following: Discuss how work groups of the future, including management, will be cross-functional and self-managed. Do you agree or disagree with this shift? Why? Give at least two examples of cross-functional teams used in other companies. Considering your examples, what do you see as challenges of using cross-functional...
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT