Question

you have following proteins protein PI MM Specific tag 1 6.4 28700 his6 tag 2 4.5...

you have following proteins

protein PI MM Specific tag
1 6.4 28700 his6 tag
2 4.5 33100 no tag
3 6.5 210111 HIS6 TAG

Which of the following methods would be the best method for separation?

2d gel electrophoresis,

ion exchange

size exclusion

isoeletric focusing

native page

SDS page

affinity chromatography

2D page

Homework Answers

Answer #1

Affinity chromatography and size exclusion chromatography

Protein 1 and 3 will be separated from Protein 2 with the help of affinity chromatography as they are his tagged, so can be separated usin column immobilised with nickel and then Protein 1 and 3 will be separated from each other with the help of size exclusion chromatography.

Protein 3 , being large in size will elute first as it will travel short distance in column where as Protein 1 being small in size will movw through pores taking time to elute

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form a disulfide bond. However, only two of them actually make a disulfide bond in the protein. Propose a series of experiments that would allow you to determine between which two amino acids the disulfide bond occurs. Pick from: Salting out, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, SDS PAGE, affinity chromatography. HINT: do not overcomplicate the question.
You have the following mixture of proteins: Protein A pI=4.3 Protein B pI=8.1 Protein C pI=6.8...
You have the following mixture of proteins: Protein A pI=4.3 Protein B pI=8.1 Protein C pI=6.8 The mixture of proteins is in a buffer at pH=7.8. You apply the mixture to a cation exchange column. Which protein(s) elute (do not bind to the column)? I believe A and C will elute because they are negatively charged. Not sure if i am correct or not. Explanation Please!
RNAPpurification. When I was a graduate student, the first protein that I purified was RNA polymerase...
RNAPpurification. When I was a graduate student, the first protein that I purified was RNA polymerase (RNAP) from E. colicells. RNAP has a net negative charge at physiological pH (7.4), although it binds and transcribes negatively charged DNA. After breaking open cells, I precipated RNAP and other proteins in the cell extract by adding solid (NH4)2SO4to a final concentration of 4 M. I spun down the protein precipitate in a centrifuge and dissolved it in a small amount of water...
Which of the following methods can be used to detect a protein band in an organelle...
Which of the following methods can be used to detect a protein band in an organelle fraction for which there is no enzyme assay? A monoclonal antibody specific for the protein is available and each fraction obtained from the fractionation experiment will be assayed. a. Immunoelectron microscopy b. ELISA assay c. Western blotting d. Immunofluorescence A membrane spanning protein that is a channel for potassium ion transport is made up of six copies of a single polypeptide. Potassium ions are...
1. Which of the following answers is (are) true about size exclusion chromatography? a. large proteins...
1. Which of the following answers is (are) true about size exclusion chromatography? a. large proteins elute first b. small proteins interact more with the column c. proteins larger than the cutoff size do not elute d. will be used to purify GFP 2. Which of the following is (are) not true about ion exchange chromotagraphy? a. positively charged proteins elute first b. negatively charged proteins elute first c. uncharged proteins elute first d. hydrophobic proteins elute first 3. The...