Question

You are to factionate a protein with Pi of 5.3 in a phosphate buffer (ph:7) using...

You are to factionate a protein with Pi of 5.3 in a phosphate buffer (ph:7) using ion exchange colum chroatography

a. what type of resin ( stationary phase) you have to choose (negative or positive functional group)

b. What woudl be the ph of your elution buffer?

Science   Biology   
0 0
Add a commentTranscribed image text
Next >

Homework Answers

Answer #1

0 0
Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
You have the following mixture of proteins: Protein A pI=4.3 Protein B pI=8.1 Protein C pI=6.8...
You have the following mixture of proteins: Protein A pI=4.3 Protein B pI=8.1 Protein C pI=6.8 The mixture of proteins is in a buffer at pH=7.8. You apply the mixture to a cation exchange column. Which protein(s) elute (do not bind to the column)? I believe A and C will elute because they are negatively charged. Not sure if i am correct or not. Explanation Please!
Using a 0.30 M phosphate buffer with a pH of 6.4, you add 0.75 mL of...
Using a 0.30 M phosphate buffer with a pH of 6.4, you add 0.75 mL of 0.49 M HCl to 46 mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.) WebAssign will check your answer for the correct number of significant figures. Incorrect: Your answer is incorrect. Using a 0.30 M phosphate buffer with a pH of 6.4, you add 0.75 mL of 0.49 M NaOH to 46 mL of...
1. Using a 0.25 M phosphate buffer with a pH of 6.8, you add 0.79 mL...
1. Using a 0.25 M phosphate buffer with a pH of 6.8, you add 0.79 mL of 0.49 M HCl to 44 mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.) ________ 2. Using a 0.25 M phosphate buffer with a pH of 6.8, you add 0.79 mL of 0.49 M NaOH to 44 mL of the buffer. What is the new pH of the solution? (Enter your answer to...
Using a 0.20 M phosphate buffer with a pH of 6.8, you add 0.72 mL of...
Using a 0.20 M phosphate buffer with a pH of 6.8, you add 0.72 mL of 0.50 M HCl to 53 mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.)
Using a 0.20 M phosphate buffer with a pH of 7.6, you add 0.72 mL of...
Using a 0.20 M phosphate buffer with a pH of 7.6, you add 0.72 mL of 0.46 M HCl to 55 mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.)
Using a 0.20 M phosphate buffer with a pH of 7.6, you add 0.72 mL of...
Using a 0.20 M phosphate buffer with a pH of 7.6, you add 0.72 mL of 0.46 M NaOH to 55 mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.)
Using a 0.25 M phosphate buffer with a pH of 6.2, you add 0.70 mL of...
Using a 0.25 M phosphate buffer with a pH of 6.2, you add 0.70 mL of 0.50 M HCl to 49 mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.)
Using a 0.30 M phosphate buffer with a pH of 6.3, you add 0.80 mL of...
Using a 0.30 M phosphate buffer with a pH of 6.3, you add 0.80 mL of 0.50 M NaOH to 60. mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.)
Using a 0.30 M phosphate buffer with a pH of 6.3, you add 0.71 mL of...
Using a 0.30 M phosphate buffer with a pH of 6.3, you add 0.71 mL of 0.51 M HCl to 50. mL of the buffer. What is the new pH of the solution? (Enter your answer to three significant figures.)
You want to express a human protein in E. coli that has been transformed by a...
You want to express a human protein in E. coli that has been transformed by a DNA plasmid containing the gene sequence for this protein. The sequence of the protein (in one-letter code) that will be expressed in E. coli is: MAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSV RCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRL RVPGCNQDLDVQKKLYDCLEEHLHHHHHHHHHH A. You proceed to express the protein, lyse open the cells, and remove the insoluble debris. With the soluble fraction of the lysate that contains your protein, you proceed to perform affinity chromatography. What specific kind...
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT