Question

2. How is the unfolded protein response involved in prion neurotoxicity?

2. How is the unfolded protein response involved in prion neurotoxicity?

Homework Answers

Answer #1

Answer -Prions is an abnormal form of a normally harmless protein found in the brain. Which is responsible for a variety of fatal neurodegenerative diseases of animals, including humans, called transmissible spongiform encephalopathies.

We analyzed activation of the unfolded protein response (UPR) during rising levels of prion protein accumulation during the course of disease as protein priorn (PrP )is synthesized in the endoplasmic reticulum ( ER).We found that there was a progressive increase in PERK-P and eIF2α-P as the disease progressed.  GADD34 levels did not change, despite the rising eIF2α-P levels, suggesting that there was insufficient GADD34 to dephosphorylate the increased amounts of eIF2α-P. This shows that the PERK/eIF2α arm of the UPR is activated in prion disease, inhibiting protein translation and leading to a reduction in the levels of synaptic proteins.

Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
Distinguish between N-glycosylation and unfolded protein response in the context of normal cell function and human...
Distinguish between N-glycosylation and unfolded protein response in the context of normal cell function and human disease progression
Stability of protein folding, calculations of folded and unfolded states of proteins from G
Stability of protein folding, calculations of folded and unfolded states of proteins from G
How are DNA, Protein and Carbohydrates involved in the structure of your cells?
How are DNA, Protein and Carbohydrates involved in the structure of your cells?
The cytoskeletal-like proteins involved in magnetotaxis are the MamZ protein and MamJ protein. the ParM protein...
The cytoskeletal-like proteins involved in magnetotaxis are the MamZ protein and MamJ protein. the ParM protein and MreB protein. the FtsZ protein and Z-ring protein. None of these choices is correct. I have tried none of the above and MamJ/Mamz. Both were incorrect.
What hormones are directly involved with sympathetic response? How do the target organs respond?
What hormones are directly involved with sympathetic response? How do the target organs respond?
How would over expression of protein phosphatase 1 affect the induction of cAMP-inducible genes in response...
How would over expression of protein phosphatase 1 affect the induction of cAMP-inducible genes in response to hormone stimulation of target cells? Would protein phosphatase 1 affect the function of cAMP-gated ion channels? Why or why not?  
Describe how negative feedback and protein synthesis (DNA to protein) play a role in blood sugar...
Describe how negative feedback and protein synthesis (DNA to protein) play a role in blood sugar level maintenance (insulin is a protein). Explain how exocytosis is involved.
in patellar reflex,identify the response observed and the effectors involved?
in patellar reflex,identify the response observed and the effectors involved?
You have managed to isolate and partially sequence a protein that you think is involved in...
You have managed to isolate and partially sequence a protein that you think is involved in making cancer cells immortal: PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTGSEMKLTS You want to know if the this protein is novel or has already been characterized. If it is novel, you want to find out whether it is similar to anything that has already been characterized. How would you find out the answers to these questions in less than a minute for less than a dollar? Is it related to...
protein code (1taq) Question 1: What is the name of the protein? Question 2: What does...
protein code (1taq) Question 1: What is the name of the protein? Question 2: What does the protein do? E.g., if it an enzyme of the Citric Acid Cycle – you must state which metabolic process it is involved in and the reaction step it catalyzes. Question 3: What are the structural features of the protein? Question 4: What are 2 features of your protein's structure that makes it different or similar to adult hemoglobin? Question 5: Based on the...
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT