Question

How does the similarity of the nucleotide sequence relate to the sequence of the amino acids?...

How does the similarity of the nucleotide sequence relate to the sequence of the amino acids? Do they have the same level of similarity?

Science   Biology   
0 0
Add a commentTranscribed image text
Next >

Homework Answers

Answer #1

0 0
Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
What is the correct amino acid sequence for the following DNA nucleotide sequence: GTAACAGAAGTACTTCCAGTACTA
What is the correct amino acid sequence for the following DNA nucleotide sequence: GTAACAGAAGTACTTCCAGTACTA
A nucleotide base sequence with 300 codons serves as the template for ______. a polypeptide containing...
A nucleotide base sequence with 300 codons serves as the template for ______. a polypeptide containing 100 amino acids a polypeptide containing 300 amino acids a polypeptide containing 900 amino acids a chromosome containing 300 genes a chromosome containing 100 alleles
Given the following DNA sequence, what is the mRNA sequence? How many amino acids would be...
Given the following DNA sequence, what is the mRNA sequence? How many amino acids would be created from this strand of DNA? TAC GGC CTA TAC GTA Please explain this process, don't just write the answer. I think it will be ARG CCG GAT ATG CAT, but I'm not sure. How would I know how many amino acids would be created? My teacher didn't really explain that part to me.
Explain why the oligosaccharides of glycoproteins are more complicated to describe than amino acids or nucleotide...
Explain why the oligosaccharides of glycoproteins are more complicated to describe than amino acids or nucleotide sequences.
A. Using the genetic code table, answer the following questions: Determine the sequence of amino acids...
A. Using the genetic code table, answer the following questions: Determine the sequence of amino acids from an mRNA sequence CCGUGU Determine the sequence of amino acids from a DNA template strand AATGTT List the start codon List the stop codons
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form...
A protein has the following sequence:   ALKJSCLKEPINWDVKLNCSLKRPILQMNLKCVGILKVN The sequence contains three amino acids that can form a disulfide bond. However, only two of them actually make a disulfide bond in the protein. Propose a series of experiments that would allow you to determine between which two amino acids the disulfide bond occurs. Pick from: Salting out, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, SDS PAGE, affinity chromatography. HINT: do not overcomplicate the question.
A three-nucleotide long sequence of mRNA that, during translation, directs the addition of a particular amino...
A three-nucleotide long sequence of mRNA that, during translation, directs the addition of a particular amino acid into a protein (or the termination of the process) is? a: Anticodon b.Codon c.Gene
How many codons code for amino acids, including the methionine codon? (1) ______ (1) How many...
How many codons code for amino acids, including the methionine codon? (1) ______ (1) How many codons do not code for amino acids? _______ (1) What do the codons that do not code for amino acids code for? Our book (and lecture) made the point at least twice that eukaryotic pre-mRNA transcripts do not have a definite, consistent end. What does this mean, and why is it so? (2)
Give the amino acid sequence of an octapeptide that contains the amino acids Phe, Lys, Thr,...
Give the amino acid sequence of an octapeptide that contains the amino acids Phe, Lys, Thr, Trp, His (2 equiv), Gly, Ser, and forms the following fragments when partially hydrolyzed with HCl: Thr―Phe―Lys―Gly, Trp―His―Ser, and Ser―His―Thr―Phe.
Common proteins are polymers of 20 different amino acids. How many amino acids are necessary for...
Common proteins are polymers of 20 different amino acids. How many amino acids are necessary for a protein polymer to have at least as many possible different sequences as there are atoms in the Universe? (There are about 2 × 1056 moles of atoms in the Universe.)
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT