Question

Given the following sequences, using approaches and ways of thinking, order them in terms of which...

Given the following sequences, using approaches and ways of thinking, order them in terms of which will be least ordered and which will be expected to fold into one unique native structure.

Protein 1

MATKESKYERVEKVNVDADGATLVKNIGEDRGKEDPGMNFQDKRPANLVPGAPAGVIPNRIESLPTDRAG

QRLREHLSESERLRVSRSSTSSKSSSFVEPSLKYRGEIGPIGKNGEFVASSNRQNSSSNVSSSDNSERAS

PASRNSNPGMNNGMTTQRTTVITESSVQGLGAQRTVPIQPHQQREDHEVITHESHARAPETTVVTIPTTR

FESAQLESRRDGRTYTEDKELTIPAPVVAPQIHAHQQVNMSGGTSATIHATTDLHLASEAQINDMGPEEY

ERYRAKVEALARIHEDETSRKAAAYRNAVEADAELIRQTLERQHMRDIEFRKDLVESSVDRQQQEIRLEA

EYAMRALEQERVNARAALDQAMASTNIDVNIDSAIGTTHSQGRVTTTSESRTSQARGPATAAVI

Protein 2

MSISIDGPKDLNDKNDKNDKNRVTHKDTGSFNKIIEGINKLRKNDIDVGCALVMSKTNMNHTDEIYDFMF
ENKLPFNVIPLNKSGNAVDNYQDLGLGPDEYYLPWSKLYDKWFYAEPKNYIFVSDFVRKTQAILAGRAAD
CIGMAQCGNTSFSVDPVGDLYPCASLSAQPDMKYGNLQNNSILELMSSTRATIYRTREGTDSCKKCKWQH
VCHGGCPARAYKYHDNDISHKDYYCPSLYKMYEHIEKRLNERGLTASKPYSKHMSDGLLGTSAFLEIEKH
KSKLIEVVNIK

Protein 3

MSRYLLRDVQAVLRGVRKVAESSLKLETEKVSLRLGDFRSQPSLRSVPASLTSRSQAFSLQEIAARAGVV
LRGVQQQFRNVTGVNAAPVVAFDNGSVLYSERIHSQSSQKQAPTTVPTGSVSNSPQPEGKANEAAERAKQ
FMNPPVAPMDPVDKNEFVAMPEMGRSNGNGENKQAADFMKNQGDTDMDSQYAPDSSKNTKSVPTKEIVAE
DGSMSIEDIKKATQVTPGVAVKNEGV
Science   Biology   
0 0
Add a commentTranscribed image text
Next >

Homework Answers

Answer #1

The protein folding identification is one of the biggest problem in biology. The protein folding is based on many factors. But as in this question , only sequences are given, so according to nature of amino acid that is beta breaker and alpha breaker, protein 1 will have least ordered followed by 2nd protein and 3rd protein.

Protein 3 is supposed to adopt unique native structures because it consist of approximate same number of acidic and basic amino acid. Sane number of positive and negative amino acid.

0 0
Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
Given the following table of protein information, what is the order (first to last) in which...
Given the following table of protein information, what is the order (first to last) in which you would assume proteins would come off a gel filtration (size exclusion chromatography) column? Molecular Wt. (da) pI(ioselectric point Protein 1 9,000 7.1 Protein 2 49,000 6.3 Protein 3 25,000 6.0 a. Protein 1, Protein 2, Protein 3 b. Protein 3, Protein 2, Protein 1 c. Protein 2, Protein 1, Protein 3 d. Protein 2, Protein 3, Protein 1 e. Protein 1, Protein 3,...
Consider the following three sequences of one hundred heads and tails each: Sequence #1: HTTHHHTTHTTHHTTHTTHTTTTHHHTTTHHTHTTHHTTTTHTTTTTHHT HTHTHHHTTTHTHHTHHTHHTHTTHTTHTTHHHHHHHTHHTTTTTHHHHH...
Consider the following three sequences of one hundred heads and tails each: Sequence #1: HTTHHHTTHTTHHTTHTTHTTTTHHHTTTHHTHTTHHTTTTHTTTTTHHT HTHTHHHTTTHTHHTHHTHHTHTTHTTHTTHHHHHHHTHHTTTTTHHHHH Sequence #2: HHTHTTTHTTHTHHHTTTHTTHHHTHTTTHTHHHTHTHTTTHTTTTHHHT THTTTHTTHHHTHTHHTTTHHHTTTHTHTTHTHTHTTTHTTHHTHHTTTH Sequence #3: THTHTHHTHHHTTTHHHTTTTTTTTTHHHTTTHHHTHTHHHTHTTTHTHH THTTHHHTTTTTTTHHTHHHHHTHHHHHHHHTHHHHHTTHHHHTTHTTHT At least one of these sequences was generated by actually tossing a quarter one hundred times, and at least one was generated by a human sitting at a computer and hitting the “H” and “T” keys one hundred times between them and trying (possibly not very hard) to make it seem random. 1. Try to figure...
1. For protein secondary structure, which of the following is incorrect? A. Secondary structure consists of...
1. For protein secondary structure, which of the following is incorrect? A. Secondary structure consists of α-helices and β-pleated sheets B. The interactions between C=O and N-H groups are hydrogen bonding interactions C. Secondary structure is created by bonding between C=O and N-H groups in the peptide backbone D. A protein can have either α-helices of β-pleated sheets, but never both 2. With regard to protein folding and denaturation, which one is incorrect? When egg white solidifies during heating, this...
Match the following terms with the best related term. 1) An enzyme that adds nucleotides together...
Match the following terms with the best related term. 1) An enzyme that adds nucleotides together based on the stretch of DNA that is being replicated. 2) The process of using DNA as a template for making RNA. 3) RNA that is incorporated as part of the ribosome structure. 4) The structure were proteins are synthesized. 5) The process of using RNA as a template for making a protein. 6) RNA that transfers amino acids to the ribosome to be...
Build a brute force approach in Python for the following problem. Given two sequences of vowels,...
Build a brute force approach in Python for the following problem. Given two sequences of vowels, find the length of longest subsequence present in both of them. NOTE: A subsequence is a sequence that appears in the same order, but not necessarily contiguous. For example, “aei”, “aeo”, “eio”, “aiu”, ... are subsequences of “aeiou”. Sample Input 1: aeiou aiu Sample Output 1: 3 Sample Input 2: uieiai uueuouiaua Sample Output 2: 4 Sample Input 3: uuuuouueea euooooe Sample Output 3:...
There are a number of problems associated with stereotyped thinking. Which of the following is one...
There are a number of problems associated with stereotyped thinking. Which of the following is one of those problems? 1) Stereotypes rarely influence what people perceive or do not perceive. 2) Once formed, stereotypes are very hard to change. 3) When confronted by evidence that contradicts a stereotype, people tend to quickly change their stereotyped way of thinking. 4) All of these answers are correct
3 In relation to the management of conflict, which of the following approaches will maximise the...
3 In relation to the management of conflict, which of the following approaches will maximise the prospect of consensus? A Acceptance B Negotiation C Avoidance D Assertiveness 4 Darragh has been appointed to the management team of a professional football club. His role includes coaching, mentoring and counselling young players who have just signed contracts with the club for the first time. The following are his main activities: 1 Helping the young players to settle in during their first week...
Given a document with terms A, B, C with the following frequencies A:3, B:2, C:1. The...
Given a document with terms A, B, C with the following frequencies A:3, B:2, C:1. The document belongs to a collection of 10000 docs. The document frequencies are A:50 B:1300 C:250. Compute the TF-IDF and compare them
1. Which of the following are ways that a firm can reduce cash flows in order...
1. Which of the following are ways that a firm can reduce cash flows in order to prevent managers from wastefully spending excess cash flows? Check all that apply. A) Funneling excess cash flows back to shareholders through higher dividends B) Minimizing the amount of debt in the firm’s capital structure so that the firm can borrow money at a reasonable rate when good investment opportunities arise C) Funneling excess cash flows back to shareholders through stock repurchases D) Increasing...
WRITE USING PYTHON PROGRAMMING THE CODE GIVEN BELOW HAS SOME ERRORS WHICH NEED TO BE SOLVED....
WRITE USING PYTHON PROGRAMMING THE CODE GIVEN BELOW HAS SOME ERRORS WHICH NEED TO BE SOLVED. ALSO THE 2 POINTS MENTIONED BELOW SHOULD BE PRESENT IN THE CODE Write a script that calculates the 3 longest words of a text stored in a file and print them from the longest to the smaller of the 3. Please note: 1. The name of the file is word_list.csv and it doesn’t need to be asked to the user (meaning the name will...
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT