Question

Given the following sequences, using approaches and ways of thinking, order them in terms of which...

Given the following sequences, using approaches and ways of thinking, order them in terms of which will be least ordered and which will be expected to fold into one unique native structure.

Protein 1

MATKESKYERVEKVNVDADGATLVKNIGEDRGKEDPGMNFQDKRPANLVPGAPAGVIPNRIESLPTDRAG

QRLREHLSESERLRVSRSSTSSKSSSFVEPSLKYRGEIGPIGKNGEFVASSNRQNSSSNVSSSDNSERAS

PASRNSNPGMNNGMTTQRTTVITESSVQGLGAQRTVPIQPHQQREDHEVITHESHARAPETTVVTIPTTR

FESAQLESRRDGRTYTEDKELTIPAPVVAPQIHAHQQVNMSGGTSATIHATTDLHLASEAQINDMGPEEY

ERYRAKVEALARIHEDETSRKAAAYRNAVEADAELIRQTLERQHMRDIEFRKDLVESSVDRQQQEIRLEA

EYAMRALEQERVNARAALDQAMASTNIDVNIDSAIGTTHSQGRVTTTSESRTSQARGPATAAVI

Protein 2

MSISIDGPKDLNDKNDKNDKNRVTHKDTGSFNKIIEGINKLRKNDIDVGCALVMSKTNMNHTDEIYDFMF
ENKLPFNVIPLNKSGNAVDNYQDLGLGPDEYYLPWSKLYDKWFYAEPKNYIFVSDFVRKTQAILAGRAAD
CIGMAQCGNTSFSVDPVGDLYPCASLSAQPDMKYGNLQNNSILELMSSTRATIYRTREGTDSCKKCKWQH
VCHGGCPARAYKYHDNDISHKDYYCPSLYKMYEHIEKRLNERGLTASKPYSKHMSDGLLGTSAFLEIEKH
KSKLIEVVNIK

Protein 3

MSRYLLRDVQAVLRGVRKVAESSLKLETEKVSLRLGDFRSQPSLRSVPASLTSRSQAFSLQEIAARAGVV
LRGVQQQFRNVTGVNAAPVVAFDNGSVLYSERIHSQSSQKQAPTTVPTGSVSNSPQPEGKANEAAERAKQ
FMNPPVAPMDPVDKNEFVAMPEMGRSNGNGENKQAADFMKNQGDTDMDSQYAPDSSKNTKSVPTKEIVAE
DGSMSIEDIKKATQVTPGVAVKNEGV
Science   Biology   
0 0
Add a commentTranscribed image text
Next >

Homework Answers

Answer #1

The protein folding identification is one of the biggest problem in biology. The protein folding is based on many factors. But as in this question , only sequences are given, so according to nature of amino acid that is beta breaker and alpha breaker, protein 1 will have least ordered followed by 2nd protein and 3rd protein.

Protein 3 is supposed to adopt unique native structures because it consist of approximate same number of acidic and basic amino acid. Sane number of positive and negative amino acid.

0 0
Know the answer?
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for?
Ask your own homework help question
Similar Questions
Given the following table of protein information, what is the order (first to last) in which...
Given the following table of protein information, what is the order (first to last) in which you would assume proteins would come off a gel filtration (size exclusion chromatography) column? Molecular Wt. (da) pI(ioselectric point Protein 1 9,000 7.1 Protein 2 49,000 6.3 Protein 3 25,000 6.0 a. Protein 1, Protein 2, Protein 3 b. Protein 3, Protein 2, Protein 1 c. Protein 2, Protein 1, Protein 3 d. Protein 2, Protein 3, Protein 1 e. Protein 1, Protein 3,...
Consider the following three sequences of one hundred heads and tails each: Sequence #1: HTTHHHTTHTTHHTTHTTHTTTTHHHTTTHHTHTTHHTTTTHTTTTTHHT HTHTHHHTTTHTHHTHHTHHTHTTHTTHTTHHHHHHHTHHTTTTTHHHHH...
Consider the following three sequences of one hundred heads and tails each: Sequence #1: HTTHHHTTHTTHHTTHTTHTTTTHHHTTTHHTHTTHHTTTTHTTTTTHHT HTHTHHHTTTHTHHTHHTHHTHTTHTTHTTHHHHHHHTHHTTTTTHHHHH Sequence #2: HHTHTTTHTTHTHHHTTTHTTHHHTHTTTHTHHHTHTHTTTHTTTTHHHT THTTTHTTHHHTHTHHTTTHHHTTTHTHTTHTHTHTTTHTTHHTHHTTTH Sequence #3: THTHTHHTHHHTTTHHHTTTTTTTTTHHHTTTHHHTHTHHHTHTTTHTHH THTTHHHTTTTTTTHHTHHHHHTHHHHHHHHTHHHHHTTHHHHTTHTTHT At least one of these sequences was generated by actually tossing a quarter one hundred times, and at least one was generated by a human sitting at a computer and hitting the “H” and “T” keys one hundred times between them and trying (possibly not very hard) to make it seem random. 1. Try to figure...
1. For protein secondary structure, which of the following is incorrect? A. Secondary structure consists of...
1. For protein secondary structure, which of the following is incorrect? A. Secondary structure consists of α-helices and β-pleated sheets B. The interactions between C=O and N-H groups are hydrogen bonding interactions C. Secondary structure is created by bonding between C=O and N-H groups in the peptide backbone D. A protein can have either α-helices of β-pleated sheets, but never both 2. With regard to protein folding and denaturation, which one is incorrect? When egg white solidifies during heating, this...
Match the following terms with the best related term. 1) An enzyme that adds nucleotides together...
Match the following terms with the best related term. 1) An enzyme that adds nucleotides together based on the stretch of DNA that is being replicated. 2) The process of using DNA as a template for making RNA. 3) RNA that is incorporated as part of the ribosome structure. 4) The structure were proteins are synthesized. 5) The process of using RNA as a template for making a protein. 6) RNA that transfers amino acids to the ribosome to be...
3 In relation to the management of conflict, which of the following approaches will maximise the...
3 In relation to the management of conflict, which of the following approaches will maximise the prospect of consensus? A Acceptance B Negotiation C Avoidance D Assertiveness 4 Darragh has been appointed to the management team of a professional football club. His role includes coaching, mentoring and counselling young players who have just signed contracts with the club for the first time. The following are his main activities: 1 Helping the young players to settle in during their first week...
Given a document with terms A, B, C with the following frequencies A:3, B:2, C:1. The...
Given a document with terms A, B, C with the following frequencies A:3, B:2, C:1. The document belongs to a collection of 10000 docs. The document frequencies are A:50 B:1300 C:250. Compute the TF-IDF and compare them
1. Which of the following are ways that a firm can reduce cash flows in order...
1. Which of the following are ways that a firm can reduce cash flows in order to prevent managers from wastefully spending excess cash flows? Check all that apply. A) Funneling excess cash flows back to shareholders through higher dividends B) Minimizing the amount of debt in the firm’s capital structure so that the firm can borrow money at a reasonable rate when good investment opportunities arise C) Funneling excess cash flows back to shareholders through stock repurchases D) Increasing...
Which one of the following terms is defined as an underwriting for which the underwriters assume...
Which one of the following terms is defined as an underwriting for which the underwriters assume full responsibility for any unsold shares? 1) Initial public offering 2) Best efforts underwriting 3) Firm commitment underwriting 4) Rights offer 5) Private placement
Your opportunity cost is 7.6 % and you are given the following 3 credit terms from...
Your opportunity cost is 7.6 % and you are given the following 3 credit terms from your suppliers. Determine the implicit interest rate (opportunity cost) of each discounted terms and determine which discounts you will take based upon the terms and opportunity cost of funds. 2/10 net 45 1/5 net 60 .5/10 net 30
3D printing is destined to change the world in ways that we cannot even understand and...
3D printing is destined to change the world in ways that we cannot even understand and the social good (or bad) they can do is endless. Thirty-three-year-old Kodjo Afate Grikou wanted to help his community in West Africa to print necessities that they can't source locally, such as kitchen utensils for cooking. The structure of the 3D printer he had in mind uses very little in terms of new parts because it is mostly made up of e-waste and scrap...
ADVERTISEMENT
Need Online Homework Help?

Get Answers For Free
Most questions answered within 1 hours.

Ask a Question
ADVERTISEMENT